Chengdu Youngshe Chem Co., Ltd.

INCI Name: Palmitoyl Dipeptide-5 Diaminohydroxybutyrate
Cas No: 794590-34-4
Formula: C35H63F6N5O9
Molecular:811.89
Sequence: Palm-Lys-Val-Dab
Purity: >95%
Source: synthetic
Odor: no
Solubility: soluble in water
Preparation: warm (for maximum 2 hours at 80�°C) or cold
Additive: 100 PPM
MSDS and COA : available for your reference
Capacity: 1kg per month
Appearance: white powder

INCI name: Palmitoyl Dipeptide-18
Reference: NANOFIBERGEL-CS
Purity: 95%
Grade: cosmetic
COA and MSDS: available
Odor: no
Grade: cosmetic
Source: synthetic
Capacity: 1kg per month
Appearance: white powder

INCI Name: Dipeptide-2
Cas No.24587-37-9
Formula: C16H21N3O3
Molecular: 303.36
Purity: >95%
Grade: cosmetic
Source: synthetic
MSDS and COA: available
Appearance: white powder

INCI Name: Dipeptide-4
Cas No: 24587-41-5
Formula: C20H21N3O3S
Molecular: 351
Purity: >95%
Formulation: available for your reference
MSDS and COA: available for your reference
Source: synthetic
Grade: cosmetic
Delivery: promptly from stock
Capacity: 1kg per month
Appearance: white powder

Name: Dipeptide-9
Cas No: 17105-15-6
MF: C11H21N3O5
Source: synthetic
Molecular:275.30
COA and MSDS: available for your reference
Appearance:� white to pale yellow powder
Solubility:� soluble in water
Stability:� stable
Capacity: 1kg per month
Appearance: white powder
2.Usage: Conditioning agent, humectant in personal care products. Good compatibility with skin. Easily absorb. good anti-aging, skin conservation effects

INCI Name: Acetyl dipeptide-3 aminohexanoate
Reference: Bodyfensine
Formula: 270
Molecular: C11H20N5O3
Source: synthetic
Grade: cosmetic
Purity: >95%
Additive: 2-5%
COA and MSDS: available for your reference
Capacity: 500g per month
Appearance: white powder

Cas No: 196604-48-5
Formula: C33H57N5O5
Molecular:603.84
Purity: >95%
Grade: cosmetic
Source: synthetic
MSDS and COA: available
Appearance: white powder

INCI Name: Ac-Leu-Leu-Argininal, Leupeptin
Cas No: 24365-47-7
Formula: C20H38N6O4
Molecular:426.55
Sequence: Ac-Leu-Leu-Argininal
Purity: >95%
Delivery: promptly from stock
Formulation: available for your reference
MSDS and COA: available for your reference
Odor: No
Source: synthetic
Stability: stable
Solubility: soluble in water
Grade: cosmetic
Capacity: 1kg per month
Appearance: white powder

INCI name: Palmitoyl Dipeptide-17
Purity: 95%
Grade: cosmetic
COA and MSDS: available
Odor: no
Source: synthetic
Capacity: 1kg per month
Appearance: white powder

INCI Name: palmitoyl lysyl-aminovaleroyl-lysine
Reference: Anew Ultimate Age Repair Night Cream
Formula: C33H65N5O5
Molecular: 611.90
Purity: >95%
Odor: no
Grade: cosmetic
Source: synthetic
Stability: stable
Appearance: white powder
Formulation: available for your reference
Delivery: promptly from stock
Recommended use level:
2.Functions: Palmitoyl Lysyl Aminovaleroyl Lysine in an amount effective to increase fibronectin levels in skin cells

Name:Bivalirudin Trifluoroacetate

Cas No:128270-60-0(net)
Formula: C100H139F3N24O35
Molecular: 2295.31
Sequence: FPRPGGGGNGDFEEIPEEYL
Also known as: CS-1433, HY-15664
Bivalirudin is a synthetic 20 residue peptide (thrombin inhibitor) which reversibly inhibits thrombin. Once bound to the active site, thrombin cannot activate fibrinogen into fibrin, the crucial step in the formation of thrombus. It is administered intravenously. Because it can cause blood stagnation, it is important to monitor changes in hematocrit, activated partial thromboplastin time, international normalized ratio and blood pressure.

INCI Name: L-Carnosine
C.A.S number :  305-84-0
Reference: Dragosine; N-beta-Alanyl-L-histidine
Molecular formula: C9H14N4O3
Molecular weight :�  226.23
Assay:�  98.0%
Grade: cosmetic,pharma
Source:synthetic
Melting point: 215-216C
MSDS and COA: available

Name: kyotorphin
Cas No: 70904-56-2� 
MF: C15H23N5O4
Molecular:337.31
Sequence: Tyr-Arg
Source: synthetic
Solubility: Soluble in water to 5 mM
Chemical name(2S)-2-[[(2S)-2-Amino-3-(4-hydroxyphenyl)propanoyl]amino]-5-
(diaminomethylideneamino)pentanoic acid
Storage instructions Store at +4C.
Purity:>95%
MSDS and COA: available

Name: N-Acetyl Carnosine
Cas No: 56353-15-2
Formula: C11H16N4O4
Grade: cosmetic
Molecular:268.27
Sequence: Acetyl-Beta-Ala-His-OH
Purity: >95%
Source: synthetic
Formulation: available for your reference
MSDS and COA: available

INCI Name: Palmitoyl Dipeptide-5 Diaminobutyroyl Hydroxythreonine
Cas No: 883558-32-5
Formula: C39H70F6N6O11
Molecular: 913
Sequence: Palm-Lys-Val-Dab-Thr
Purity: >95%
Solubility: soluble in water
Grade: cosmetic
Odor: no
Source: synthetic
Preparation: warm (for maximum 2 hours at 80�°C) or cold
MSDS and COA : available for your reference
Capacity: 1kg per month
Appearance: white powder

INCI Name: Palmitoyl Dipeptide-7
Reference: palestrina
Cas No: 911813-90-6
Formula: C26H51N3O5
Molecular:485.7
Purity: >95%
Grade: cosmetic
Source: synthetic
Formulation: available for your reference
Delivery: promptly from stock
Capacity: 1kg per month
Appearance: white powder

Name:Cathelicidin-BF
Molecular:3637.54
Isoelectric point:11.79
Sequence:� lysine-phenylalanine-phenylalanine-arginine-lysine-leucine-lysine-lysine- serine-valine-lysine-lysine-arginine-alanine-lysine-glutamicacid-phenylalanine-phenylalanine-lysine-lysine-proline-arginine-valine-isoleucine-glycine-valine-serine-isoleucine-proline-phenylalanine
Purity:98%
Appearance: white powder
Source: synthetic

Name: Collagen Tripeptide
Cas No: 2239-67-0
Formula: C12H19N3O5
Molecular:285.3
Purity: â?§95%
MSDS and COA: available for your reference, please contact us.
Delivery: promptly from stock
Source: botanical
Stability: Stable
Grade: cosmetic
Capacity: 800g per month
Appearance: light yellow or almost white powder� 

2.Usageï¼?anti-photo-aging agent
3.Descriptiom: Collagen tripeptide� (CTP) is a functional food material with several biological effects such as improving dry skin and wound and bone fracture healing.
Collagen molecule consists of 3,000 amino acids, can hardly be absorbed by human gastrointestinal use, not to direct absorption by the skin. Tripeptide collagen is 3,000 amino acids according to 1 / 1000 of shearing, forming a function of the smallest molecular structure of collagen, or a combination of three amino acids. Tripeptide collagen collagen than usual excellent with more absorbent, can penetrate the dermis, and bring better effect of moisture. And collagen III peptide itself has anti-inflammatory and regenerative capacity of the cell has, so you can remove facial pock metabolism to generate healthy skin.

INCI Name: IAMIN
Cas No: 32999-80-7
Formula: C10H15N5O4
Molecular:269.26
Sequence: Cu-HGG
Purity: â?§95%
MSDS and COA: available for your reference, please contact us.
Delivery: promptly from stock
Source: synthetic
Stability: Stable
Grade: cosmetic
Capacity: 3kg per month
Appearance: blue powder

INCI Name::AHK, Tripeptide-3
Cas No: 89030-95-5, 49557-75-7,130120-57-9
Formula: C15H26N6O4( AHK)
Molecular: 353.0(AHK)
Sequence: AHK
Purity: â?§95%
Solubility:� slightly soluble in water
Stability:� stable
Odor: no
Grade: cosmetic
Source: synthetic
Formulation: available for your reference, please contact us.
COA and MSDS: available for your reference, please contact us.
Delivery: promptly from stock
Capacity: 10kg per month
Appearance: white powder
2.Functions Tripeptide-3 effectively increase collagen and elastin production. It prevent hair loss, improve hair growth and supply nutrients for hair.

INCI Name: Palmitoyl Tripepitde-5
Reference: SYN-COLL
Cas No: 623172-56-5
Formula: C33H65N5O5
Molecular:611.9
Sequence: Pal-KVK
Purity: â?§95%
Stability: stable
Solubility: soluble in water
Stability:� stable
Odor: no
Grade: cosmetic
Source: synthetic
Formulation: available for your reference, please contact us.
COA and MSDS: available for your reference, please contact us.
Delivery: promptly from stock
Capacity: 1kg per month
Appearance: white powder
2.Usage:
1. Any type of anti-ageing products to reduce the appearance of wrinkles and fine lines.
2.Volume boosting products
3.Suitable for facial and body care
3.Descriptionï¼?Palmitoyl Tripepitde-5� is a synthetic peptide designed to stimulate the skin's natural mechanism to produce collagen. It is based on a small peptide developed to reduce any type of wrinkles. Clinical trials have shown that Palmitoyl Tripepitde-5 is capable of reducing and changing the type and aspect of wrinkles that add years to your appearance.

INCI Name: Palmitoyl Tripeptide-8
Reference: Neutrazen
Solubility: soluble in water
Stability: stable
Purity: >95%
Odor: no
Grade: cosmetic
Source: synthetic
MSDS and COA: available for your reference
Capacity: 100g per month
Appearance: white powder
2.Functions:
1. Palmitoyl Tripeptide-8 Prevents & reverses signs of neurogenic inflammation
2. Palmitoyl Tripeptide-8 Calms & soothes irritated skin
3. Palmitoyl Tripeptide-8 Helps to maintain & restores a normal sensitivity threshold.

INCI Name: Tetrapeptide-1
Formula: C20H36N4O6
Molecular:428
Sequence:
Purity: >95%
Solubility: soluble in water
Stability:  stable
Odor: no
Grade: cosmetic
Source: synthetic
Formulation: available for your reference, please contact us.
COA and MSDS: available for your reference, please contact us.
Delivery: promptly from stock
Recommended use level:
Capacity: 700g per month
Appearance: white powder

INCI Name: Caprooyl Tetrapeptide-3
Reference: ChroNOline
Formula:
Molecular:
Purity: >95%
Grade: cosmetic
Source : synthetic
Formulation: available for your reference, please contact us.
MSDS and COA: available for your reference, please contact us.
Delivery: promptly from stock
Additive:
- Intensive treatment: 2.5%
- Preventive treatment: 1% to 2.5%
- Skin repair treatment: 0.3% to 1%
Appearance: white powder
2.Functions:
1. Caprooyl Tetrapeptide-3 Reduces fine lines & wrinkles after 28 days
2. Caprooyl Tetrapeptide-3 Provides a continuous long term reduction of fine lines & wrinkles in mature skin
3. Caprooyl Tetrapeptide-3 Rejuvenates aging skin
4. Caprooyl Tetrapeptide-3 Makes the skin smoother, firmer, more even for a younger rested look
5. Caprooyl Tetrapeptide-3 Helps reduce the appearance of stretch marks

INCI name: Acetyl Tetrapeptide-5
Reference: Eyeseryl
Cas No: 820959-17-9
Formula: C20H28N8O7
Molecular:492
Sequence: Ac-Beta-Ala-His-Ser-His-OH
Purity: >95%
Odor: no
Grade: cosmetic
Source: synthetic
Stability: stable
Solubility:soluble in water
Peptide Solution: 0.1%
Capacity: 600g per month
Appearance: white powder

Formulation: available for your reference, please contact us
MSDS and COA: available for your reference, please contact us
Delivery: promptly from stock
2.Usage: Acetyl Tetrapeptide-5 reduces puffy eyebags
3.Description Acetyl Tetrapeptide-5 has clinically proven anti-edema (reduces fluid build-up) properties and also improves the circulation in the under eye area. When applied topically, this ingredient helps prevent and visibly reduces puffiness.

INCI name: Myristoyl Tripeptide-31
Reference: DermaPep A350
Purity: 95%
Grade: cosmetic
Solubility:  slightly soluble in water.
Stability:  stable
Source: synthetic
COA and MSDS: available for your reference
Capacity: 500g per month
Appearance: white powder
2.Function
1.Anti-aging for face and body
2.Increase of collagen synthesis
3.Providing exceptional anti-aging benefits
4.Anti-aging effect against environmental stimulus such as UV irradiation

3.Applications
Myristoyl Tripeptide-31 can be incorporated in cosmetic formulations such as emulsions, oily sera, gels and creams for anti-aging and anti-wrinkle purpose.
4.Usage: Myristoyl tripeptide-31 is a multifunctional retinoic acid-like tripeptide,it is very effective in reversing age-related changes, such as wrinkles, mottled hyperpigmentation, and can be a powerful substitute for retinoids without any side effects.

INCI name: Palmitoyl Tripeptide-36
Molecular: 402.53
MF: C18H38N6O4
MSDS and COA: available for your reference
Purity: 95%
Grade: cosmetic
Solubility: slightly soluble in water
Stability:  stable
Source: synthetic
Odor: no
Capacity: 600g per month
Appearance: white powder
2.Usage: Palmitoyl Tripeptide-36. It is an active anti-microbial agent and preservative. It inhibits S.aureus and other bacteria, fungi on the skin surface of AD patients. Applications include anti-microbial and preservatives.

INCI Name:Palmitoyl Tripeptide-38
Reference: Matrixyl synthe'6,Volulip
Formula: C33H65N5O7S
Molecular:675.96
Purity: 95%
Solubility: slightly soluble in water
Stability: stable
Source: synthetic
Odor: no
MSDS and COA: available for your reference
Delivery: promptly from stock
Capacity: 200g per month
Appearance: white powder
2.Description:
1.Palmitoyl Tripeptide-38  is a powerful anti wrinkle peptide acting on 6 skin rebuilding essentials and tested with success on the forehead.

2.Also Palmitoyl Tripeptide-38 and Portulaca pilosa extract can are used to plump lips by hyaluronic acid synthesis. It improves the internal and superficial lip texture with a visible impact on the lip shape. This product increases of the lip volume, hydration and softness. It offers anti-aging and anti-sagging effects.

INCI name: Dimer Tripeptide-43
Reference: Prolixir S20
Purity: 95%
Solubility: slightly soluble in water
Stability: stable
Source: synthetic
Odor: no
MSDS and COA: available for your reference
Delivery: promptly from stock
Capacity: 500g per month
Appearance: white powder
2.Functions:
1.Helps detoxify young and stressed skin
2.Helps maintain natural defense of aged skin
3.Provides visible benefits by decreasing the appearance of skin wrinkles and improving skin tonicity and beauty

INCI name:Tripeptide-44
Cas No: 556-33-2
MF: C6H11N3O4
MW: 189.17
Purity: 95%
Solubility: slightly soluble in water
Stability: stable
Source: synthetic
MSDS and COA: available for your reference
Delivery: promptly from stock
Capacity: 500g per month
Appearance: white powder

Reference: Syn-TC
Cas No: 883558-32-5
Purity: 95%
Delivery: promptly from stock
Formulation: available for your reference
Delivery: promptly from stock
MSDS and COA: available for your reference
Odor: No
Source: synthetic
Stability: stable
Solubility: soluble in water
Grade: cosmetic
Appearance: white powder
Delivery: promptly from stock
Capacity: 500g per month
Solution: 0.1-1%(both peptide)
Recommended use level: 1-2.5%.
2.Usage:
1.Skin smoothing products
2.High performing facial anti-ageing formulas
3. Anti-wrinkle and anti-photo ageing solutions
4. Plumping beauty products

3.Description
SYN-TC is a synthetic peptide based complex tailor made for optimal activity on all relevant skin collagen types. It combines best performance on each collagen in a well balanced composition. SYN-TC significantly increases the formation of undamaged, stable and homogenous collagen to facilitate their unique contribution to beautiful smooth skin and is easy to formulate in gels, cream gels and emulsions.

INCI name: Myristoyl Tetrapeptide-6
Reference: DermaPep A420, Dermapep Wrincare
Purity: >95%
Grade: cosmetic
Source: synthetic
Appearance: white powder
Formulation: available for your reference, please contact us.
MSDS and COA: available for your reference, please contact us
Delivery: promptly from stock
Odor: no
Stability: stable
Solubility: soluble in water
Capacity: 600g per month
Appearance: white powder
2.Functionï¼?
1.Anti-aging for face and body
2.Increase of collagen synthesis
3.Providing exceptional anti-aging benefits
4.Anti-aging effect against environmental stimulus such as UV irradiation

INCI name: Palmitoyl Tetrapeptide-7
Reference:DermaPep A410, Regestril , Corum 8804 / 8814 / 8814CC
Cas No: 77727-17-4
Formula: C34H62N8O7
Molecular: 694.91
Sequence: Pal-Gly-Gln-Pro-Arg
Source: synthetic
Grade: cosmetic
Capacity: 1500g per month
Additive: 500 PPM
2.Introduction:
Palmitoyl Tetrapeptide-7 mimics the activity of DHEA, the� youth hormone that� functions to� reverse IL-6 over-production, and therefore reduce the aging symptoms as well as the� phenomenon of immunosenescence.

Palmitoyl Tetrapeptide-7 can enhance the functions in a variety of skin care and color cosmetic formulation. They are available in both water dispersible form (Corum 8804) and oil dispersible form (Corum 8814 / 8814CC)
3.Functions:
1. Palmitoyl Tetrapeptide-7 Mimics DHEA activity to regulate and maintain cellular regeneration
2. Palmitoyl Tetrapeptide-7 Restores cellular activity
3.Wound healing

Name: Acetyl Tetrapeptide-9
Reference: Dermican LS 9837
EINICS number: 231-791-2, 200-289-5, 478-960-9
Purity: >95%
Grade: cosmetic
Delivery: promptly from stock
Formulation: available for your reference, please contact us.
MSDS and COA: available for your reference, please contact us
Odor: no
Stability: stable
Solubility: soluble in water
Appearance: white powder
Recommended dose: 1-3%
2.Usage: anti-aging and skin smoothing
3.Description: Acetyl Tetrapeptide-9 is a synthetic tetrapeptide that provides targeted action on dermal structure via stimulation of lumican and collagen synthesis. It creates a global restructuring of the skin matrix, which is clinically proven to improve skin thickness and firmness. Acetyl Tetrapeptide-9 is a water-soluble powder.

INCI Name: Palmitoyl Tetrapeptide-10
Reference: Avon Anew Ultimate Age Repair Elixir
Formulation: available for your reference, please contact us.
MSDS and COA: available for your reference, please contact us
Delivery: promptly from stock
Purity: >95%
Odor: no
Grade: cosmetic
Source: synthetic
Stability: stable
Solubility: soluble in water
Capacity: 600g per month
Appearance: white powder
2.Usage: stimulate MAGP-1 expression and which improves the appearance of aged and/or photo damaged skin

INCI Name: Acetyl Tetrapeptide-11
Reference: Syniorage
Cas No: 7732-18-5
EINICS number: 231-791-2
Purity: >95%
Grade: cosmetic
Delivery: promptly from stock
Formulation: available for your reference, please contact us.
MSDS and COA: available for your reference, please contact us
Delivery: promptly from stock
Odor: characteristic
Stability: stable
Solubility: soluble in water
Appearance: white powder
Recommended dose: 1-3%
2.Usage: Acetyl Tetrapeptide-11 is ideally used in anti-age face care, radiant senior skin care, and specific care for mature skin. It is a white powder, with a characteristic odor, is soluble in water, but insoluble in oils and fats.

INCI Name: Myristoyl Tetrapeptide-12
Cas No: 959610-24-3
Formula: C32H63N7O5
Molecular: 625.89
Purity: >95%
Source: synthetic
Grade: cosmetic
Formulation: available for your reference, please contact us.
MSDS and COA: available for your reference, please contact us
Delivery: promptly from stock
Odor: characteristic
Stability: stable
Solubility: soluble in water
Appearance: white powder
Solution: 500PPM in water
Solution additive: 0.02%

2.Usage: Myristoyl Tetrapeptide-12 enhances the appearance of eyelashes and/or eyebrows

Name: Tetrapeptide-14
Reference: Granactive AR-1423
Formula:
Molecular:
Source: synthetic
Grade: cosmetic
Formulation: available for your reference, please contact us.
MSDS and COA: available for your reference, please contact us
Delivery: promptly from stock
Odor: characteristic
Stability: stable
Solubility: soluble in water
Capacity: 600g per month
Appearance: white powder
2.Usage: Tetrapeptide-14 is a unique delivery matrix that combines a redness and inflammatory diminishing peptide with the anti-oxidant properties of tea, the calming properties of boswellia serrata and the soothing quality of honey.

3.Description: Tetrapeptide-14 is a specific peptide sequence that can be used in cosmetic treatments to alleviate the redness associated with rosacea or mild sun exposure-Acts by down regulating interleukin-6 (IL-6) to prevent inflammation, which
in turn reduces MMP-1 damage with the net effect of a bright and even skin
appearance -Also reduces likelihood of post inflammatory pigmentation along with
improving overall skin health

INCI Name: Acetyl Tetrapeptide-15
Reference: Skinasensyl
Formula: C34H39N5O6
Molecular: 613.7
Source: synthetic
Grade: cosmetic
Formulation: available for your reference, please contact us.
MSDS and COA: available for your reference, please contact us
Delivery: promptly from stock
Odor: characteristic
Stability: stable
Solubility: soluble in water
Capacity: 800g per month
Appearance: white powder
Usage: Acetyl Tetrapeptide-15 reduces discomfort and painful sensations in sensitive skin
Description: Acetyl Tetrapeptide-15 is new synthetic tetrapeptide which helps relieve sensitive skin by normalizing the tolerance threshold for environmental factors, certain topically applied uncomfortable products or skin care treatments. It mimicks a natural opioid peptide and was developed with the aim to decrease the stimulation of the skin's nerve endings.

Name: Tetrapeptide-16
Reference: Granactive AR-1423
Source: synthetic
Grade: cosmetic
Formulation: available for your reference, please contact us.
MSDS and COA: available for your reference, please contact us
Delivery: promptly from stock
Odor: characteristic
Stability: stable
Solubility: soluble in water
Capacity: 800g per month
Appearance: white powder
2.Description:This Tetrapeptide-16 inhibit ultraviolet light (UV)-induced expression of the pro-inflammatory cytokine interleukin-6 (IL-6) by skin epithelial cells and fibroblasts. Furthermore, the tetrapeptides repress the upregulation of matrix metalloproteinase-1 (MMP-1) by skin fibroblasts induced by either direct exposure to UV rays or treatment with media conditioned by UV-treated keratinocytes. The small size and bio-activity of the tetrapeptides render them suitable for use in therapies directed to inflammatory skin disorders and as active ingredients in skin care products.

INCI name: Myristoyl Tetrapeptide-20
Reference: Dermapep T430
Purity: >95%
Source: synthetic
Grade: cosmetic
Grade: cosmetic
Formulation: available for your reference, please contact us.
MSDS and COA: available for your reference, please contact us
Delivery: promptly from stock
Odor: characteristic
Stability: stable
Solubility: soluble in water
Capacity: 800g per month
Appearance: white powder
2.Function
1.Skin-tanning effect
2.Strong anti-inflammatory effect
3.Protective effect of skin against UV-induced damage and photo-aging
4.Anti-skin cancer effect
5.Gorgeous glow

INCI Name: Tetrapeptide-21
Reference: TEGO pep4-17
MF: 389.4
Purity: 95%
Grade: cosmetic
Additive: 2000 PPM
Source: synthetic
Formulation: available for your reference, please contact us.
MSDS and COA: available for your reference, please contact us
Delivery: promptly from stock
Odor: characteristic
Stability: stable
Solubility: soluble in water
Capacity: 800g per month
Appearance: white powder
2.Functions: Tetrapeptide-21 is a new bioactive tetrapeptide with superior collagen boosting activity,it can minimizes the appearance of wrinkles and reduces skin roughness

INCI Name: Acetyl Tetrapeptide-22
Reference: Thermostressine
Purity: >95%
Source: synthetic
Grade: cosmetic
Formulation: available for your reference, please contact us.
MSDS and COA: available for your reference, please contact us
Delivery: promptly from stock
Odor: characteristic
Stability: stable
Solubility: soluble in water
Solution: 0.05% peptide
Recommended use level:2-5 %
Appearance: white powder
2.Usage: Acetyl Tetrapeptide-22 Helps fight cellular stress and increases HSP70 levels to prevent further stress
3.Description: Acetyl Tetrapeptide-22 that increases HPS70 (Heat Shock Protein) levels in skin providing a protective shield, that confers cells a stress tolerance against everyday challenges and stressful stimuli. It helps skin to be more relaxed with a more vital appearance. It can be incorporated in cosmetic formulations such as emulsions, gels, serums to fight stress and treat fragile, tired and dull skin.

INCI name: Tetrapeptide-26
Reference: Chronogen biofunctional
Purity: >95% by HPLC
Tetrapeptide-26 Concentration:
Source: synthetic
Odor: no
Stability: stable
Grade: cosmetic
MSDS and COA: available for your reference
Capacity: 800g per month
Appearance: white powder
2.Functions:
1.Associated with a maintenance of expression of CLOCK, BMAL1 and PER1
2.A decrease of indued sun burn cells
3.repair of UV damage

INCI Name:Tetrapeptide-30
Reference: TEGO Pep4-Even
M.W: C22H40N6O7
M.F.: 500.60
Purity: >95% by HPLC
Additive:50-500 PPM
Source: synthetic
Grade: cosmetic
Odor: no
Stability: stable
MSDS and COA: available for your reference
Appearance: white powder
2.Usage: skin brightening
3.Introduction:
Tetrapeptide-30 is a tetrapeptide which is active on all kinds of skin types. It visibly dimishes hyperchromatic spots and brightens the skin. Additionally it is able to reduce acne lesions and to alleviate melasma on ethnic skin.

These tetrapeptides inhibit ultraviolet light (UV)-induced expression of the pro-inflammatory cytokine interleukin-6 (IL-6) by skin epithelial cells and fibroblasts. Furthermore, the tetrapeptides repress the upregulation of matrix metalloproteinase-1 (MMP-1) by skin fibroblasts induced by either direct exposure to UV rays or treatment with media conditioned by UV-treated keratinocytes. The small size and bio-activity of the tetrapeptides render them suitable for use in therapies directed to inflammatory skin disorders and as active ingredients in skin care products.

Tetrapeptide-30 is a tetrapeptide which is active on all kinds of skin types. It visibly dimishes hyperchromatic spots and brightens the skin. Additionally it is able to reduce acne lesions and to alleviate melasma on ethnic skin.

Name: Acetyl Tetrapeptide-33/Acetyl Tetrapeptide-40
Reference: TELANGYN
Purity: >95% by HPLC
Additive: 50-500 PPM
Source: synthetic
Grade: cosmetic
Odor: no
Stability: stable
MSDS and COA: available for your reference
Appearance: white powder
2.Function: This tetrapeptide reduces redness of face caused by an inflammatory reaction.Adverse effects of inflammation: redness, dilated blood vessels and hyperpigmentation, are visibly reduced. The red areas are less numerous and large and its intensity is weaked. The skin is more uniform and less marked.

INCI name: Myristoyl Tetrapeptide-34
Reference: Dermapep A440
Source: synthetic
Stability: stable
Appearance: white or off-white powder
COA and MSDS: available for your reference
Grade: cosmetic
Capacity: 400g per month
Purity: >95%
Functions: anti-wrinkle, anti-inflammatory

INCI name: Acetyl Pentapeptide-1
Molecular:720
Appearance: white or off-white powder
COA and MSDS: available for your reference
Purity: 95%
Grade: cosmetic
Source: synthetic
Capacity: 300g per month
Appearance: white powder
2.Usage: Acetyl Pentapeptide-1 can improve collagen protein and elastin protein
synthesis anti-wrinkle;It help skin thickness and firm, make skin firming .

INCI name: PENTAPEPTIDE-25
Reference: UCPEPTIDE V
Purity: >95%
Source: synthetic
Grade: cosmetic
Stability: stable
Solubility: soluble in water
Odor: no
Formulation: available for your reference, please contact us.
MSDS and COA: available for your reference, please contact us.
Delivery: promptly from stock
Recommended dose: 50 PPM
Capacity: 500g per month
Appearance: white powder
2.Usage:
1 - Synthetic peptide biomimetic of UCPs (uncoupling proteins)
2- PENTAPEPTIDE-25 Restricts the storage of lipids
3- PENTAPEPTIDE-25 Reduces the volume of vacuoles in adipocytes and adipocytes size

3.Description: UCPEPTIDE V is a UCP-like peptide obtained by synthesis and designed for slimming skin care products.The sequence of UCPEPTIDE V is similar to a common sequence in uncoupling proteins (UCPs), a universal family of mitochondrial transporters that allow energy to be released as heat.

INCI name: Pentapeptide-34 Trifluoroacetate
Reference: Peptide Q10
Purity: 95%
Source: synthetic
Grade: cosmetic
Stability: stable
Solubility: soluble in water
Odor: no
Formulation: available for your reference, please contact us.
MSDS and COA: available for your reference, please contact us.
Delivery: promptly from stock
Recommended dose: 0.5%-1%
Appearance: white powder
2.Usage:
1. Pentapeptide-34 Trifluoroacetate Help enhance natural endogenous synthesis of CoQ10.
2.Antioxidant: Pentapeptide-34 Trifluoroacetate may help skin protect against free radicals.
3.Energy: Pentapeptide-34 Trifluoroacetate may enhance ATP synthesis.
4.Anti-aging: Pentapeptide-34 Trifluoroacetate helps diminish the appearance of wrinkles and fine lines.

Reference: SymPeptide 225
Additive: 500ppm
Odor: no
Stability: stable
Capacity: 500g per month
Appearance: white powder

Mechanism:
In vitro: (DNA microarray) fibroblast growth factor upregulation, collagen
and III upregulation, fibronectin, elastin, and other matrix protein upregulation,
MMP-1 downregulation

Functions:
Myristoyl Pentapeptide-11 Rejuvenates cells for younger skin.
Myristoyl Pentapeptide-11 Increases collagen production to smooth skin and fill fine lines and wrinkles.
Myristoyl Pentapeptide-11 Offers preventative aging benefits by protecting skins vital structural proteins.
Peptides with enhanced penetration capabilities

Reference: SymPeptide 380
Additive: 1000ppm
Odor: no
Stability: stable
Capacity: 500g per month
Appearance: white powder

Mechanism:
In vitro: DNA microarray, MIC against P. acnes, broad spectrum antimicrobial

Functions:
Myristoyl Hexapeptide-23 that helps with prevention of problem skin
Myristoyl Hexapeptide-23 Kills acne-causing bacteria

Name:Acetyl Hexapeptide-1
Reference: Melitane
Formula: C43H59N13O7
Molecular:870
Purity: 95%
Source: synthetic
Grade: cosmetic
Stability: stable
Solubility: soluble in water
Odor: no
Formulation: available for your reference, please contact us.
MSDS and COA: available for your reference, please contact us.
Delivery: promptly from stock
Appearance: white powder
Suggested concentration:0.55%
2.Function: 1.Agonist of -MSH
2.Stimulates melanin synthesis
3.Description:
1. Acetyl Hexapeptide-1 Stimulates hair pigmentation and reverses the gray hair process.
2. Acetyl Hexapeptide-1 Induces skin pigmentation.
3. Acetyl Hexapeptide-1 Strengthens the skins defenses against harmful effects of UV
4. Acetyl Hexapeptide-1 Reduces skin erythema.
5. Acetyl Hexapeptide-1 Protects and repairs DNA damage caused by UV exposure (UVA & UVB).
6. Acetyl Hexapeptide-1 Reduces the inflammatory response.Fight back hair graying, melitane decreases the number of unpigmented and low pigmented cells. It also increases the number of moderated and highly pigmented cells in hair bulb.

INCI Name: Hexapeptide-2
Reference: Dermostatyl IS biofunctional
Molecular: C46H56N12O6
MSDS and COA: available for your reference
Source: synthetic
Purity: 95%
Additive:50-250 PPM
Source: synthetic
Grade: cosmetic
Stability: stable
Solubility: soluble in water
Odor: no
Formulation: available for your reference, please contact us.
MSDS and COA: available for your reference, please contact us.
Appearance: white powder
2.Functions: skin brightening
3.Introduction: Hexapeptide-2 is a skin lightening peptide to brighten skin and even-out skin tone. This peptide obtained by synthesis acts as an antagonist to -MSH. The binding of -MSH to its receptors mediates skin pigmentation. It competes for -MSH binding to its receptors, thereby decreasing melanin synthesis. Hexapeptide-2 induces a decrease in the melanin content in epidermal cells.

INCI Name: Acetyl Hexapeptide-3, Acetyl Hexapeptide-8
Reference: Argireline
Cas No: 616204-22-9
Formula: C34H60N14O12S
Molecular:887
Sequence: Ac-Glu-Glu-Met-Gln-Arg-Arg-NH2
Purity: 95%
Source: synthetic
Grade: cosmetic
Stability: stable
Solubility: soluble in water
Odor: no
Formulation: available for your reference, please contact us.
MSDS and COA: available for your reference, please contact us.
Delivery: promptly from stock
Capacity: 1000g per month
Appearance: white powder
2.Usage smooth wrinkles
3.Description:
Acetyl hexapeptide-3 is an anti-aging skincare product that claims to reduce lines and wrinkles. It's meant to be another option for those who want younger-looking skin, but do not want to go through Botox injections, face-lifts, or other more invasive procedures. In addition, Acetyl hexapeptide-3 is much less expensive than those more widely used techniques.
Argireline is a unique new peptide that both reduces the degree of existing facial wrinkles and has been demonstrated effective against their development. It's been shown to inhibit the formation of the SNARE complex ( a core of membrane proteins that mediates neuronal exocytosis) as well as catecholamine release. These inhibitions confer anti-aging activity of Acetyl Hexapeptide-3(ARGIRELINE); they closely relate to the basic biochemical mechanisms of winkle formation.Controlled studies have also demonstrated that facial winkle depth can be reduced, especially in the forehead and around he eyes, and that Acetyl Hexapeptide-3(ARGIRELINE) can prevent apparent facial skin ageing.

INCI name: sh-Hexapeptide-2
Reference: Actopontine
Purity: 95%
Source: synthetic
Grade: cosmetic
Stability: stable
Solubility: soluble in water
Odor: no
Formulation: available for your reference, please contact us.
MSDS and COA: available for your reference, please contact us.
Delivery: promptly from stock
Peptide Solution:
Recommended level:
Capacity: 100g per month
Appearance: white powder
2.Usage:
1. sh-Hexapeptide-2 Increase in proteins critical for building and remodeling the Extracellular Matrix: dermatopontin, collagen I, collagen III, laminin-V, fibronectin and alpha-3 integrin
2. sh-Hexapeptide-2 Enhance proteins involved in cell shape and integrity: paxillin for fibroblasts shape, moesin known as a marker of cell longevity and integrity
3.For potential enhancement of skin elasticity and density: tropo-elastin and elastin-associated proteins involved in elastin fiber assembly, skin density and fiber orientation known to contribute to a youthful appearance
3.Description:
Sh-hexapeptide-2 is a bio-engineered peptide inspired by the role of dermatopontin in matrix-forming systems. It enhances skins appearance by boosting elasticity and density for a younger, fresher look. It may be effective in enhancing skin elasticity and firmness by increasing proteins involved in the architecture of the extracellular matrix, those associated with cell shape and integrity and those supporting the dermal and epidermal junction.

INCI name: Myristoyl Hexapeptide-4
Reference: Sympeptide 230, Collasyn 6KS
Water: not more than 10%
Acetic acid: not more than 15%
Sample: available
Purity: 95%
Source: synthetic
Grade: cosmetic
Stability: stable
Solubility: soluble in water
Odor: no
Formulation: available for your reference, please contact us.
MSDS and COA: available for your reference, please contact us.
Delivery: promptly from stock
Peptide Solution:
Recommended level: 500PPM
Capacity: 600g per month
Appearance: white powder
2.Function:This product helpsrestore skin elasticity.It is effective for Anti-aging,anti-wrinkle,skin-firming.

INCI Name: Hexapeptide-9 (Collagen Peptide)
Reference: Collaxyl
Formula: C24H38N8O9
Purity: 95%
Source: synthetic
Grade: cosmetic
Odor: no
Stability: stable
Solubility: soluble in water
Formulation: available for your reference, please contact us.
MSDS and COA: available for your reference, please contact us.
Delivery: promptly from stock
Recommended use levels: 0.5% - 1.5%
Capacity: 500g per month
Appearance: white powder
2.Usage Hexapeptide-9 reduces the length and depth of wrinkles
3.Description: Hexapeptide-9 is a peptide which in a nutshell forces skin to heal itself.  It plays the role of a messenger that quickly triggers the skin into regeneration of its damaged cells. There was an experiment done by the makers of Hexapeptide-9 on a DEAD piece of skin. They ripped the skin, to simulate the damage done to cells during an injury like repeated acne breakouts.  The scientists applied Hexapeptide-9 1 time, and left it on the dead skin for 72 hours.  This is the image from the experiment, as seen through a microscope. Remember, this was on dead skin, so imagine well it can work on live skin.

INCI Name: Hexapeptide-11
Reference: Peptamide 6, Vital Hair & Scalp Complex
Formula: C36H48N6O7
Molecular: 676.8
Purity: 95%
Source: synthetic
Grade: cosmetic
Odor: no
Stability: stable
Solubility: soluble in water
Formulation: available for your reference, please contact us.
MSDS and COA: available for your reference, please contact us.
Delivery: promptly from stock
Recommended use levels:
Capacity: 500g per month
Appearance: white powder
Recommended: 2.8% solution
2.Usage firm and maintain skin integrity
3.Description:
Hexapeptide-11 is a biofermented peptide that has been shown in studies,run on human dermal fibroblasts,to upregulate key genes responsible for collagen production and important extracellular matrix components such as hyaluroni acid.

Hexapeptide-11 A natural peptide (derived from baker s yeast) shown in clinical studies to promote collagen and elastin formation, helping to firm and maintain skin integrity.

INCI name: Acetyl Decapeptide-3
Reference: Rejuline
MW: 1491
Purity: 95%
Grade: cosmetic
Source: synthetic
COA and MSDS: available for your reference
Appearance:� white to pale yellow powder
Solubility:� slightly soluble/soluble in water
Stability:� stable
Risk:� irritation, low irritation to skin, eye
Ph value: 6.0-7.5
Additive: 100 PPM with 500 PPM concentration
Appearance: white powder
2.Functions:
1- Acetyl Decapeptide-3 Reduces and prevent lines and wrinkles by actively generating new skin cells.积æ??ç??æ??æ?°ç??ç?®è?¤ç»?è??æ?¥å??å°?å??é¢?é?²çº¿æ?¡å??ç?±çº¹
2- Involve in normal skin growth, healing and wound repair.å??ä¸?正常ç??ç?®è?¤ç??é?¿ï¼?æ??å??å??伤å?£ä¿®å¤?
3- Acetyl Decapeptide-3 Strengthens skin elasticity by inducing the synthesis of collagen and elastin.é??è¿?诱导è?¶å??è??ç?½å??å¼¹æ?§è??ç?½ç??å??æ??æ?¥å¢?强ç?®è?¤å¼¹æ?§
4- More stable and prolong action than native proteins.æ¯?天ç?¶è??ç?½è´¨æ?´ç¨³å®?å??延é?¿ä½?ç?¨

INCI Name: Oligopeptide-10,Peptide HB64
Reference: Granactive ACNE
Cas No: 466691-40-7
Formula: � C78H140N20O15
Molecular: 1612
Grade: cosmetic
Source: synthetic
Odor: no
Stability: stable
Structure:
MSDS and COA: available for your reference, please contact us.
Purity: â?§95%
Delivery: promptly from stock
Additive:1000-3000 PPM
Capacity: 200g per month
Appearance: white powder
2.Functionï¼?anti-acne
3.Formulation:
1. Oligopeptide-10 Can be formulated into oil-in-water emulsions, water-in-oil emulsions and other formula types
2. Oligopeptide-10 is ready to dilute into an active containing water phase or improving an existing o/w emulsion
3.Add to the water phase of all emulsion types;
4.Description: Oligopeptide-10� has broad-spectrum activity against many types of organisms, including� p. acne� bacteria.� Oligopeptide-10 is A short bioactive peptide consisting of fifteen naturally occurring amino acids that provides anti-microbial activity against p-acne bacterium.
Oligopeptide-10 has potent activity against Propionibacterium acnes causing rapid cell death. It binds to negatively charged surface elements (lipoteichoic acids) of bacteria enabling access to its primary target, the cytoplasmic membrane which causes a lethal osmotic imbalance within the bacteria. Due to this unique mechanical mechanism of action bacteria have a very low probability of becoming resistant and bacteria resistant to other antibiotics remain susceptible to Oligopeptide-10. In addition, it neutralizes pro-inflammatory bacterial components, reducing redness. In independent studies Oligopeptide-10 has been shown to be non-cytotoxic, non-mutagenic, non-irritating and non-sensitizing.
Used in many acne products to enhance natural defense systems, Oligopeptide-10 is an anti-microbial peptide derived from plant amino acids that is highly synergistic with salicylic acid. Studies have demonstrated that Oligopeptide-10 has broad-spectrum activity against many types of organisms, including p. acnes bacteria. Clinical studies have shown a significant reduction in the appearance of blemishes and red, blotchy spots after using products with Oligopeptide-10.

INCI name: Oligopeptide-20
Reference: CG-IDP5
MW: 1476
Purity: 95%
Stability: stable
Grade: cosmetic
Source: synthetic
Odor: no
COA and MSDS: available for your reference
Additive: 500 PPM concentration
Capacity: 300g per month
Appearance: white powder
2.Usage:
1.Reduce and prevent lines and wrinkle.
2.Strengthen skin elasticity by inducing the synthesis of collagen and elastin.
3.Involve in normal skin growth, healing and wound repair.
å??å°?å??é?²æ­¢çº¿æ?¡å??ç?±çº¹ã??
é??è¿?诱导è?¶å??è??ç?½å??å¼¹æ?§è??ç?½ç??å??æ??æ?¥å¢?强ç?®è?¤å¼¹æ?§ã??
å??ä¸?正常ç??ç?®è?¤ç??é?¿ï¼?æ??å??å??伤å?£ä¿®å¤?ã??
3.Application: Anti-wrinkle / Wound Healing
4.Descritpion: Oligopeptide-20 is a synthetic 12 amino acid peptide consisting of alanine, arginine, cysteine, glutamic acid, leucine, lysine, methionine, proline and tyrosine.Oligopeptide-20,acts as an anti-wrinkle, skin lifting and firming active. It is a double layered encapsulated biomimetic peptide which strengthens skin elasticity by inducing the synthesis of collagen and elastin. It is involved in normal skin growth, healing and wound repairing. It reduces and prevents lines and wrinkles by actively generating new skin cells. Used in skin care products.

INCI Name: Pal-AHK
Cas No: 147732-56-7
Formula: C31H56N6O5
Molecular:592.8
Sequence: Pal-AHK
Purity: â?§95%
MSDS and COA: available for your reference, please contact us.
Delivery: promptly from stock
Source: synthetic
Stability: Stable
Odor: no
Grade: cosmetic
Capacity: 2kg per month
Appearance: white powder
Functions: Palmitoyl Tripeptide (Pal-AHK) effectively increase collagen and elastin production. It prevent hair loss, promote wound healing improve hair growth and supply nutrients for hair growth.

INCI Name: Copper Tripeptide-1(GHK-Cu)
Cas No: 89030-95-5, 49557-75-7,130120-57-9
Formula: C14H24N6O4
Molecular: 340.5
Sequence: (Gly-His-Lys)2.Cu.Hac
Purity: â?§95%
Solubility:� soluble in water
Stability:� stable
Source: synthetic
Odor: slightly
Formulation: available for your reference
MSDS and COA: available for your reference
Delivery: promptly from stock
Capacity: 10kg per month
Appearance: Blue powder
2.Usage Copper Tripeptide-1 can be used for anti-wrinkle,hair regrowth,wound repair, skin remodelin
3.Description:
Copper is an important trace element that has been found to be important in wound healing and enzymatic processes.Lysyloxidase is an important enzyme in collagen and elastin production and it is dependent upon the action of copper. Tyrosinase and cytochrome c oxidase require copper as well.The detrimental effects of free radicals on the skin have been elucidated in basic science research into skin photoaging. Superoxide dismutase acts as an important antioxidant and requires copper as a cofactor. The peptide GHK spontaneously complexes with copper and facilitates the uptake of copper by cells. This peptide sequence is found in proteins of the extracellular matrix such as the �±chain of collagen, and it is believed to be released during wounding and inflammation. A feedback stimulation of collagen repair has also been proposed for this peptide, but the main benefit to photoaged skin is believed to be the enhanced delivery of copper.

INCI Name: Trifluoroacetyl Tripeptide-2
Synonym: ECM-Protect, Progeline
Cas No: 64577-63-5
Formula: C21H28F3N3O6
Molecular:475.47
Solubility:� slightly soluble in water
Stability:� stable
Odor: no
Grade: cosmetic
Source: synthetic
Formulation: available for your reference, please contact us.
COA and MSDS: available for your reference, please contact us.
Delivery: promptly from stock
Appearance: white powder
2.Usage: Trifluoroacetyl Tripeptide-2 reduces progerin synthesis, MMP and elastase inhibitor, increases syndecan, contracts collagen to reduce signs of aging including sagging and wrinkles
Description: Trifluoroacetyl Tripeptide-2 is a 3 amino acids peptide biomimetic of elafin that modulates progerin, a new senescence marker, for a complete remodelling effect and reduction of the appearance of wrinkles.

INCI name: Palmitoyl Tripeptide-30
Reference: melatime
Purity: >95%
Grade: cosmetic
Solubility:� slightly soluble in water.
COA and MSDS: available for your reference
Stability:� stable
Source: synthetic
Capacity: 500g per month
Appearance: white powder
2.Description:
This tripeptide accelerates, intensifies and extends the tanning. It stimulates the tanning process of the skin exposed to UV rays, maintaining its intensity for longer while preserving a nice shade.
3.Mechanism of action
Palmitoyl Tripeptide-30 stimulates the production of cAMP, increasing melanin synthesis and, therefore, accelerating the tanning process under UV rays.
4.Functions:
Palmitoyl Tripeptide-30 bronzes the skin quickly and intensely, in harmony with the natural tone. The tan lasts longer, up to 2 weeks after having stopped the exposure to the sun.

INCI name: Dipeptide-2,Palmitoyl Tetrapeptide-3, Hesperidin Methyl Chalcone
Reference: Eyeliss
Content:
1.Hesperidin Methyl Chalcone
2.Dipeptide-2
3.Palmitoyl Tetrapeptide-3
Purity: 95%
Solubility: soluble in water
Stability: stable
Odor: no
Grade: cosmetic
Source: synthetic
Formulation: available for your reference, please contact us.
COA and MSDS: available for your reference, please contact us.
Delivery: promptly from stock
Capacity: 500g per month
Appearance: yellow-white powder
Recommended use level: 3%.
2.Usage: Eyeliss helps prevent puffiness and ,reduce bags under the eyes.
3.Description: Eyeliss helps reduce puffiness and bags under the eyes. Puffy eyes are due to fluid build-up caused by poor drainage, fragile capillaries, and loss of elasticity. Fluid leaks into surrounding tissues and produces "bags".
Eyeliss targets all three conditions by improving drainage, reducing capillary fragility, and reducing irritation and skin slackening while increasing skin firmness and elasticity.

INCI Name: Acetyl Tetrapeptide-3
Reference: Capixyl
Cas No: 827306-88-7, 155149-79-4
Formula: C22H38N8O6
Molecular: 510.59
Purity: >95%
Grade: cosmetic
Source: synthetic
Stability: stable
Appearance: white powder
Chemical structure:
Formulation: available for your reference, please contact us.
Delivery: promptly from stock
2.Usageï¼?hair growth stimulant,improves hair anchoring� 

3. Description: Acetyl Tetrapeptide-3 is an innovative biomimetic peptide combined with a red clover extract. It targets the main causes of hair loss, providing fuller and thicker hair.

Mode of Action:
DHT Modulation via inhibition of 5-�±-reductase
Stimulates ECM renewal and anchoring proteins
Properties:

Provides fuller, thicker and healthier hair and eye lashes
Reduces inflammation in the scalp

Capixyl has a direct action on DHT preventing the hair cycle to shorten and hair follicle miniaturization, improving the ECM proteins for better anchoring and promoting an increase of follicle size. It has better effect than Minoxidil.

Capixyl increase the A A/T (Anagen/Telogen) ratio by 46% compared to a reduction of -33% by the placebo. (20 drops per day for 4 months)

0.0006% Acetyl tetrapeptide-3 improves by 35% the hair follicle length in comparison with untreated area after 8 days of treatment.

BPC157
Basic information:
Name: BPC157
Formular: C43H66N12O12S2
Molecular:1419
Sequence: Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val
Purity:98%
Appearance: white powder
Source: synthetic

Bombesin
1.Basic information:
Name: Bombesin
Cas No: 31362-50-2
Formula: C71H110N24O18S
Molecular: 1619.87
Sequence: Pyr-Gln-Arg-Leu-Gly-Asn-Gln-Trp-Ala-Val-Gly-His-Leu-Met-NH2
Purity:98%
Appearance: white powder
Source: synthetic
MSDS and COA: available for your reference

INCI name: Myristoyl Dipeptide-13
Reference: DermaPep Pepanagen
Purity: 95%
Grade: cosmetic
COA and MSDS: available
Odor: no
Grade: cosmetic
Source: synthetic
Capacity: 1kg per month
Appearance: white powder
2.Usage: Myristoyl Dipeptide-13 is An effective hair growth stimulating peptide; promotes cell proliferation and increases the hair density on human.

INCI Name:Palmitoyl Tripeptide-1(Palmitoyl Oligopeptide)
Reference: DermaPep A310,Bio-bustyl, Corum 8803 / 8813 / 8813CC,Maxilip
Cas No: 147732-56-7
Formula: C30H54N6O5
Molecular:578.8
Sequence: Pal-GHK
Activity: Stimulate collagen and glycosaminoglycan synthesis
Purity: 95%
Source: synthetic
Stability: Stable
Grade: cosmetic
MSDS and COA: available for your reference
Delivery: promptly from stock
Capacity: 1kg per month
Appearance: white powder
2.Usage Anti-wrinkle and firming effect.
3.Description: This peptide sequence is found in proteins of the extracellular matrix such as the �±chain of collagen, and it is believed to be released during wounding and inflammation. A feedback stimulation of collagen repair has also been proposed for this peptide, but the main benefit to photoaged skin is believed to be the enhanced delivery of copper.It is found to have the beneficial effects on collagen stimulation.

Palmitoyl Tripeptide-1 is a matrikine, it stimulates collagen and glycosaminoglycan synthesis. Palmitoyl Tripeptide-1 reinforces the epidermis and diminishes wrinkles.

INCI Name: Tripeptide-3
Reference: AT Peptide IS
Formula: C14H24N8O4
Molecular: 368
Purity: â?§95%
Stability:� stable
Odor: no
Grade: cosmetic
Source: synthetic
Formulation: available for your reference, please contact us.
COA and MSDS: available for your reference, please contact us.
Delivery: promptly from stock
Concentration additive: 1.5 PPM
Capacity: 5kg per month
Appearance: white powder
2.Functions:
1.Increases ATP levels
2.Increases intracellular calcium
3.Helps lipolysis

3.Introduction: Tripeptide-3 is an energy-boosting peptide specially designed to help
revitalize aging skin as well as help smooth the appearance of cellulite prone skin

INCI Name: Tripeptide-6
Reference: CG-CTP
Cas No: 951775-32-9
Formula: C12H19N3O5
Molecular:285.30
Sequence: Pro-Hyp-Gly
Solubility:� soluble in water
Stability:� stable
Purity: >95%
Odor: no
Grade: cosmetic
Source: synthetic
MSDS and COA: available for your reference
Capacity: 1kg per month
Appearance: white powder
2.Functions:
1.Hydrate dry skin and maintain its optimum moisture balance.
2.Promote skin elasticity by inducing the synthesis of collagen and elastin.
3.Reduce and prevent lines and wrinkles by actively generating new skin cells.

INCI Name: Tripeptide-9 citrulline
Reference: dGlyage
Cas No: 951775-32-9
Solubility: soluble in water
Stability: stable
Source: synthetic
Purity: 95%
MSDS and COA: available for your reference, please contact us.
Grade: cosmetic
Capacity: 100g per month
Appearance: white powder
2.Functions: Tripeptide-9 citrulline Reduces DNA damage resulting from fenton reaction products and reduces metal-mediated A.G.E. formation
3.Introduction: Tripeptide-9 citrulline prevents DNA structure changes triggered by transition metals.It chelates such ion metals that catalyse different reaction producing several DNA lesions.Miscrofluidised liposomes with diminished particle size contain the tetrapeptide,thus delivery to the skin is enchanced.

INCI Name: Acetyl Tripeptide 30 Citrulline
Synonym: Peptide AC29
Reference: Vanistryl
Purity: 95%
Solubility:� slightly soluble in water.
Stability:� stable
Source: synthetic
Grade: cosmetic
COA and MSDS: available for your reference
Capacity: 100g per month
Appearance: white powder
2.Functions:
1. Acetyl Tripeptide 30 Citrulline prevents the degradation of the extracelullar matrix components that get
disrupted in the formation of stretch marks.
2. Acetyl Tripeptide 30 Citrulline prevents the formation of new stretch marks by giving more strength to skin to withstand distension.
3.The skin recovers its elasticity (+44% in 2 months), visibly attenuating stretch marks. 4.The body achieves a smoother and even skin.
3.Descriptions: PEPTIDE AC29 is a new synthetic tetrapeptide that inhibits selectively human MMPs.

INCI Name: Diaminopropionoyl Tripeptide-33
Reference: Preventhilia
Purity: 95%
Source: synthetic
Solubility: soluble in water
Stability: stable
MSDS and COA: available for your reference, please contact us.
Delivery: promptly from stock
Capacity: 200g per month
Appearance: white powder
2.Functions: Diaminopropionoyl Tripeptide-33 skin protect-prevents the damage caused directly or indirectly by UV radiation to DNA and proteins, thus preventing photo-aging

4.Description: Diaminopropionoyl Tripeptide-33 is a Tetrapeptide born from preventive cosmetics that protects skin cells from UVA-induced DNA damages and is able to promote the DNA repair system capacity, providing a complete skin protection of intrinsic and extrinsic aging.

INCI name: Palmitoyl Tripeptide-40
Reference: melatime
Purity: 95%
Grade: cosmetic
Solubility:  slightly soluble in water
COA and MSDS: available for your reference
Stability:  stable
Source: synthetic
Capacity: 600g per month
Appearance: white powder
2.Description:
This tripeptide accelerates, intensifies and extends the tanning. It stimulates the tanning process of the skin exposed to UV rays, maintaining its intensity for longer while preserving a nice shade.

3.Mechanism of action
It stimulates the production of cAMP, increasing melanin synthesis and, therefore, accelerating the tanning process under UV rays.
4.Functions:
It bronzes the skin quickly and intensely, in harmony with the natural tone. The tan lasts longer, up to 2 weeks after having stopped the exposure to the sun.

INCI Name: Dipeptide Diaminobutyroyl Benzylamide Diacetate
Reference: SYN-AKE
Cas No: 823202-99-9
Formula: C23H37N5O7
Molecular: 495.56
Sequence: H--Ala-Pro-Dab-NH-Bzl
Purity: 95%
Formulation: available for your reference
MSDS and COA: available for your reference
Odor: No
Source: synthetic
Stability: stable
Solubility: soluble in water
Grade: cosmetic
Capacity: 500g per month
Appearance: white powder
Delivery: promptly from stock
Solution: 0.1-1%
Recommended use level: 1 - 4%.
2.Usage:
1. SYN-AKE helps reduce wrinkles and laughter lines
2.Age-defying products particularly effective against expression lines
3.Intensive wrinkle-smoothing products

INCI name: Tetradecyl aminocarbonyl-Dab-Val-Dab
Reference: Syn-HYCAN
Cas No: 934368-60-2
Formula: 785
Molecular:785
Sequence: Tetradecyl aminocarbonyl-Dab-Val-Dab
Purity: 95%
Formulation: available for your reference
MSDS and COA: available for your reference
Odor: No
Source: synthetic
Stability: stable
Solubility: soluble in water
Grade: cosmetic
Appearance: white powder
Delivery: promptly from stock
Capacity: 500g per month
Solution: 0.1-1%
Recommended use level: 2.5%.
2.Usage:
1.Firming and body remodelling treatment
2.Anti-sagging treatment
3.Beauty from within skin care through topical application
3.Description Loss of skin firmness is one very visible sign of aging. SYN-HYCAN helps to fight sagging skin by boosting hyaluronan content and increasing the expression of decorin and lumican. Both activities of SYN-HYCAN work nicely together: Fresh hyaluronan and stronger collagen fibrils result in a visible remodeling effect and a firmer skin.

Reference:Syn-TACKS
Cas No: 883558-32-5
Purity: 95%
Formulation: available for your reference
Delivery: promptly from stock
MSDS and COA: available for your reference
Odor: No
Source: synthetic
Stability: stable
Solubility: soluble in water
Grade: cosmetic
Appearance: white powder
Delivery: promptly from stock
Capacity: 500g per month
Solution: 0.1-1%(both peptide)
Recommended use level: 1%.
2.Usage:
1.Anti-wrinkle and anti-ageing products
2.Skin restructuring and smoothing products
3.Skin nourishing and skin repair treatments

INCI Name: Palmitoyl Tripepitde-5
Reference: SYN-COLL, REGU-STRETCH
Cas No: 623172-56-5
Formula: C33H65N5O5
Molecular:611.9
Sequence: Pal-KVK
Purity: 95%
Stability: stable
Solubility: soluble in water
Stability: stable
Odor: no
Grade: cosmetic
Source: synthetic
Formulation: available for your reference, please contact us.
COA and MSDS: available for your reference, please contact us.
Delivery: promptly from stock
Appearance: white powder
Capacity: 500g per month
Solution: 0.1-1%
Recommended use level: 1-3%.
2.Usage:
1. Any type of anti-ageing products to reduce the appearance of wrinkles and fine lines
2.Volume boosting products
3.Suitable for facial and body care

3.Description Palmitoyl Tripepitde-5 is a synthetic peptide designed to stimulate the skin's natural mechanism to produce collagen. It is based on a small peptide developed to reduce any type of wrinkles. Clinical trials have shown that Palmitoyl Tripepitde-5  is capable of reducing and changing the type and aspect of wrinkles that add years to your appearance.

INCI Name: Pentapeptide-3
Reference: Vialox
Cas No: 725232-44-0,135679-88-8
Formula: C21H37N9O5
Molecular: 495.58
Sequence: H-Gly-Pro-Arg-Pro-Ala-NH2
Purity: 95%
Appearance: white powder
Odor: no
Stability: stable
Solubility: soluble in water
Source: synthetic
Formulation: available for your reference, please contact us
MSDS and COA: available for your reference, please contact us
Capacity: 500g per month
2.Usage: face cream and anti wrinkles creams to treat crows feet and wrinkles
3.Functions:
1. Pentapeptide-3 Reduce the depth of expression wrinkles, especially in the forehead and around eyes
2. Pentapeptide-3 Target the wrinkle formation mechanism of expression wrinkles in a new way, offering a alternative or complement to peptides like acetyl-hexapeptide-3.
4.Description: Pentapeptide-3 is an anti-wrinkle ingredient that is very potent. It is found in the form of a powder kit and has been proven to reduce wrinkling by 49%. It works by reducing the contraction of muscle cells. It is widely known to be similar to Botox, but is a topical cream, not an injection, making it attractive to those who do not like the idea of injections on their face.

The use of Pentapeptide-3 can exhibit a Botox-like reduction in wrinkles. Used twice a day, for 28 days, volunteers using Pentapeptide-3 in clinical studies applied the substance on half the face. The subjects were women who were between the ages of thirty and sixty. The primary use of Pentapeptide-3 was for the decrease in Crow's feet wrinkles, but it has now been found to be effect on other facial wrinkle.

INCI name:Oligopeptide-6
Reference: Peptide Vinci 01
MSDS and COA: available for your reference
Source: synthetic
Odor: no
Stability: stable
Purity: 95%
Grade: cosmetic
Capacity: 500g per month
Appearance: white powder

INCI Name: Palmitoyl hexapeptide-6,Palmitoyl hexapeptide-14
Reference: InvisaSkin Matrix Rebuilder-O, Granactive Powder 168-EL
MSDS and COA: available for your reference, please contact us.
Purity: 95%
Source: synthetic
Grade: cosmetic
Stability: stable
Solubility: soluble in water
Odor: no
Delivery: promptly from stock
Appearance: white powder
2.Functions: Wrinkle treatment, anti-aging and face lift products in serum, gel cream and lotion forms. 
3.Description
Palmitoyl Hexapeptide-14 is a short bioactive peptide modified with palmitoyl for enhanced delivery and has proven to stimulate collagen production, stimulate proliferation of fibroblast cells and inhibit skin damaging MMPs. It helps reduce the appearance of fine lines and wrinkles, while eliminating dull and dry skin by rejuvenating and restoring tissue building processes. In independent studies Palmitoyl Hexapeptide-14 has been shown to be non-cytotoxic, non-mutagenic, non-irritating and non-sensitizing.

INCI Name: Acetyl Hexapeptide-30
Reference: Inyline
Purity: 95%
Grade: cosmetic
Source: synthetic
Odor: no
Formulation: available for your reference, please contact us.
MSDS and COA: available for your reference, please contact us.
Delivery: promptly from stock
Additive: 25 PPM
Appearance: white powder
2.Usage: Acetyl Hexapeptide-30 reduces depth of wrinkles caused by contraction of muscles of facial expression.
3.Description: Acetyl Hexapeptide-30 that targets the agrin/MuSK post synaptic pathway acting as a competitive antagonist of MuSK(muscle specific kinase) at the agrin binding site, to minimize muscle contraction reducing expression wrinkles.

INCI Name: Acetyl Hexapeptide-51 Amide
Reference: Juveleven,Juvefoxo
Purity: 95%
Source: synthetic
Grade: cosmetic
Stability: stable
Solubility: soluble in water
Odor: no
MSDS and COA: available
Formulation: available for your reference
Peptide contains: 0.05%
Recommended dose: 2%
Appearance: white powder
2.Functions:
Acetyl Hexapeptide-51 Amide mimics the activity of FOXO3a, which is a member of the Forhkead box transcription factors and is involved in cell repair, renewal and longevity.

Cellular senescence is reverted, and UV-mediated DNA damage is diminished (-16.6% in 24 h), all this contributing to achieving a younger look for longer.

3.Description:
Acetyl Hexapeptide-51 Amide protects DNA from damage, stimulates its natural repair pathways and enhances cellular longevity and vitality.

INCI Name: Acetyl Octapeptide-8, Acetyl Octapeptide-3,Acetyl Glutamyl Heptapeptide-1 
Reference: SNAP-8
Cas No: 868844-74-0
1253115-75-1
Formula: C41H70N16O16S
Molecular:1075.18
Sequence:  Ac-Glu-Glu-Met-Gln-Arg-Arg-Ala-Asp-NH2
Purity: 95%
Stability: stable
Additive: 500 PPM
Source: synthetic
Grade: Cosmetic
Formulation: available for your reference, please contact us.
MSDS and COA: available for your reference, please contact us.
Delivery: promptly from stock
Capacity: 400g per month
Appearance: white powder
2.Usage: anti-wrinkle, smooth wrinkles.
3.Description The anti wrinkle octapeptide SNAP-8 is an elongation of the famous hexapeptide ARGIRELINE. SNAP-8 reduces the depth of wrinkles on the face caused by the contraction of muscles of facial expression, especially in the forehead and around eyes. SNAP-8 is a safer, cheaper, and milder alternative to Botulinum Toxin, topically targeting the same wrinkle formation mechanism in a very different way.

INCI Name: Heptapeptide-6
Purity: 95%
MSDS and COA : available for your reference
Delivery: promptly from stock
Odor: no
Stability: stable
Source: synthetic
Grade: cosmetic
Capacity: 400g per month
Appearance: white powder
2.Functions:  
1. Heptapeptide-6 Treatment of cellulite
2. Heptapeptide-6 Decrease, eliminate or prevent excess fat beneath the skin

INCI name: Octapeptide-2
Reference: Proharin-b4
Odor: no
Stability: stable
Capacity: 500g per month
Appearance: white powder
Solution: 10-25 PPM
Usage: Octapeptide-2 promotes hair growth and improves wrinkles.

INCI Name: Nonapeptide-1
Reference: Melanostatine-5, Melanostatine
Cas No: 158563-45-2
Formula: C61H87N15O9S
Molecular: 1206.52
Sequence: MPFRWFKPV
Purity: >95%
Density (Predicted)
Value: 1.38�±0.1 g/cm3 | Condition: Temp: 20 �°C Press: 760 Torr
pKa (Predicted)
Value: 13.32�±0.46 | Condition: Most Acidic Temp: 25 �°C
Source: synthetic
Grade: cosmetic
Odor: no
Stability: stable
Solubility: soluble in water
MSDS and COA: available for your reference, please contact us.
Delivery: promptly from stock
Capacity: 600g per month
Appearance: white powder
2.Application: Skin Radiance /� Skin Lightening-whitening /� Anti-dark Spot
ç?®è?¤äº®ç?½/ç¾?ç?½/æ??é»?æ??
3.Functions:
1. Nonapeptide-1 Blocks the binding of �±-MSH with its receptor MC1R on the cell membrane of melanocyte. The successive melanine producing process is stopped.� 
2.A whitening agent that works on the very initial stage of skin darkening mechanism. Highly efficacious.
3. Nonapeptide-1 Prevents further activation of tyrosinase & thus blocks melanin synthesis for better control over skin tone & brown spots.
4. Nonapeptide-1 Prevents hyperproduction of melanin
5.Whitening activity proven on Asian skin

INCI name: LZ1 peptide
Molecular:2227.77
Purity: 95%
Isoelectric point:12.5
Grade: cosmetic
Sequence:valine-lysine-arginine-tryptophan-lysine-lysine-tryptophan-tryptophan-arginine-lysine-tryptophan-lysine-lysine-tryptophan-valine-NH2
COA and MSDS: available for your reference
Additive:
Odor: no
Stability: stable
Solubility: soluble in water
Source: synthetic
Capacity: 500g per month
Appearance: white powder
2.Functions: anti-bacteriaæ??ç»?è??
3.Introduction: The antibacterial peptide LZ1 is small in molecular weight, strong in bactericidal effect and wide in antibacterial spectrum, almost does not have hemolytic activity or eukaryocyte toxicity, It is a small molecular antibacterial peptide with application value, is convenient to artificially synthesize, and can be used for preparing an antibacterial medicament.

INCI Name: Oligopeptide-68
Reference: �²-White, beta-white
Cas No: 1206525-47-4
Appearance: white powder
Purity: >95%
Source: synthetic
Grade: cosmetic
Concentration:0.5-5%
Formulation: available for your reference, please contact us.
Delivery: promptly from stock
2.Usageï¼?bleaching
3.Description: Oligopeptide-68 â?? is a complex combination of TGF-�? agonist peptide that inhibits Microphtalmia-associated transcription factor (MITF). MITF is a major transcriptional regulator of melanogenic� enzymes,� tyrosinase, TRP-1 and TRP-2. This peptide induces significant skin lightening shown to have a higher activity than� Arbutin� and vitamin� C.ç?®è?¤å¢?ç?½

Name: sH-Oligopeptide-1
Reference: Nepidermin
Cas No: 62253-63-8
Formula: Câ??â??â??Hâ??â??â??Nâ??â??Oâ??â??Sâ??
Molecular: 6216
Structure:H-Asn-Ser-Asp-Ser-Glu-Cys-Pro-Leu-Ser-His-Asp-Gly-Tyr-Cys-Leu-His-Asp-Gly-Val-Cys-Met-Tyr-Ile-Glu-Ala-Leu-Asp-Lys-Tyr-Ala-Cys-Asn-Cys-Val-Val-Gly-Tyr-Ile-Gly-Glu-Arg-Cys-Gln-Tyr-Arg-Asp-Leu-Lys-Trp-Trp-Glu-Leu-Arg-OH
(Disulfide bonds between Cys6 and Cys�²0/Cys�¹4 and Cys�³�¹/Cys�³�³ and Cys4�²)
Purity: â?§95%
Source: synthetic
Grade: cosmetic
Stability: stable
Solubility: soluble in water
Formulation: available for your reference, please contact us.
Delivery: promptly from stock
Capacity: 50g per month
Appearance: white powder
2.Functionï¼?increase the rate of healing and renewal of the skin, as well as slow the thinning of aging skin, thus minimising wrinkleså¢?å? ç?®è?¤æ??å??å??æ?´æ?°é??度ï¼?并å??ç¼?è??å??ç?®è?¤ç??å??è??ï¼?ä»?è??å??å°?ç?±çº¹

INCI Name: Glutathione
Cas No: 70-18-8
Formula: C10H17N3O6S
Molecular: 307.32
Sequence: Glu-Cys-Gly
Purity: >95%
Boiling Point: 756.4±60.0 C at 760 mmHg
Vapour Pressure:: 0.0±5.5 mmHg at 25C
Enthalpy of Vaporization: 119.9±6.0 kJ/mol
Flash Point: 411.3±32.9 C
Source: synthetic
Stability: stable
Appearance: white powder
Formulation: available for your reference
Delivery: promptly from stock
2.Functions: antioxidant, whitening
3.Description:

Name: Dipeptide-8
COA and MSDS: available for your reference
Appearance: white to pale yellow powder
Solubility: soluble in water
Stability: stable
Source: synthetic
Capacity: 1kg per month
Appearance: white powder
2.Usage: Conditioning agent, humectant in personal care products. Good compatibility with skin. Easily absorb. good anti-aging, skin conservation effects.

Name: Aditpotide
Sequence: CKGGRAKDC-GG-D(KLAKLAK)2
Molecular formula: C111H204N36O28S2
Molar Mass: 2555.22 g/mol
PeptideSequence: H-Cys-Lys-Gly-Gly-Arg-Ala-Lys-Asp-Cys-Gly-Gly-Asp-(Lys-Leu-Ala-Lys-Leu-Ala-Lys)2
CID 439302

INCI Name: Palmitoyl Dipeptide-10, PALMITOYL CARNOSINE
Reference: Corum 8802 / 8812 / 8812CC
Cas No: 324755-72-8
Formula: C25H44N4O4
Molecular:464.33
Purity: >95%
Additive: 100 PPM
MSDS and COA : available for your reference
Delivery: promptly from stock
Source: synthetic
Grade: cosmetic
Capacity: 1kg per month
Appearance: white powder
2.Functions:
1.In palmitoylated form to increase skin penetration. � 
2.Protects skin proteins, mainly collagens and elastins by:
3.Anti-oxidation preventing from degradation  
4.Anti-glycation preventing from protein-sugar reaction  
5.Anti-carbonylation preventing from protein-protein crosslinks
6.Also protects DNA from the attack of free radicals.
7.Upgrades the total quality of skin cells and ECM proteins.

INCI name: Methyl Undecenoyl Dipeptide-16
Reference: DermaPep W220
Purity: 95%
Appearance: white powder
Grade: cosmetic
Source: synthetic
Stability: stable
Additive:100-200 PPM
2.Function:
1.Whitening for face and body
2.Inhibition of melanogenic pathway
3.Providing exceptional whitening benefits
4.Anti-inflammation effect against environmental stimulus such as UV irradiation

3.Applications:
Methyl Undecenoyl Dipeptide-16 can be incorporated in cosmetic formulations such as emulsions, oily sera, gels and creams for skin-whitening and anti-inflammatory
purposes.

Name:Antide Acetate(Iturelix)

Cas:112568-12-4
Formula: C82H108ClN17O14
Molecular:1591.29
Sequence: (N-Acetyl-3-(naphhalen-2-yl)-D-alanyl)-p-chloro-D-phenylalanyl-3-(3-pyridyl)-D-alanyl-L-seryl-N(sup 6)-nicotinyl-L-lysyl-N(sup 6)-nicotinyl-D-lysyl-L-leucyl-N(sup 6)-isopropyl-L-lysyl-L-prolyl-D-alaninamide
Also known as: Iturelix, Orf 23541, BRN 4866881, D-Alaninamide, N-acetyl-3-(2-naphthalenyl)-D-alanyl-4-chloro-D-phenylalanyl-3-(3-pyridinyl)-D-alanyl-L-seryl-N6-(3-pyridinylcarbonyl)-L-lysyl-N6-(3-pyridinylcarbonyl)-D-lysyl-L-leucyl-N6-(1-methylethyl)-L-lysyl-L-prolyl-, D-Alaninamide, N-acetyl-3-(2-naphthalenyl)-D-alanyl-4-chloro-D-phenylalanyl-3-(3-pyridinyl)-D-alanyl-L-seryl-N(sup 6)-(3-pyridinylcarbonyl)-L-lysyl-N(sup 6)-(3-pyridinylcarbonyl)-D-lysyl-L-leucyl-N(sup 6)-(1-methylethyl)-L-lysyl-L-prolyl-, Nal-Lys-GnRH

Bradykinin Acetate

1.Basic information:
Name: Bradykinin Acetate
Synonym:BK;L-Bradykinin;Callidin I;CallidinI;Callidin-I;KallidinI;Kallidin I;Kallidin-I;C acid;C-acid;Kallidin 9;Kallidin-9;Kallidin9;Bradykinin
Cas No: 5979-11-3
Formula: C50H73N15O11
Molecular: 1060.22
Sequence: H-Arg-Pro-Pro-Gly-Phe-Ser-Pro-Phe-Arg-OH acetate salt
Purity:98%
Appearance: white powder
MSDS and COA: available for your reference
Source: synthetic
Solubility:� 
1.Always dissolve peptides in distilled (preferably sterile) water first. The concentration should be high enough to allow for addition of buffer after the product is dissolved completely.
2.If necessary, a few drops of dilute acetic acid or ammonium hydroxide can be added to help solublilize the peptide. In those rare cases were solubilization is still not achieved, the solution may be sonicated briefly.
3.Buffer or saline should be added only after the peptide is fully in solution, in order to avoid serious solubility problems.

Name:Bremelanotide
Cas No:
Formula: C50H68N14O10
Molecular:1025.16
Sequence:
Also known as: HS-2024, PT-141, 189691-06-3, PT-141, CHEMBL2070241, AKOS005145807

Name:Buserelin Acetate, Buserelina
Cas No: 57982-77-1 (net), 68630-75-1 (acetate)
Formular: C62H90N16O15
Molecular: 1299.47
Sequence:His-Trp-Ser-Tyr-D-Ser(tBu)-Leu-Arg-Pro-NHET
Purity:98%
Appearance: white powder
Source: synthetic
Also known as: Receptal, Suprecur, Suprefact, HOE 766MP, HOE 766 MP, Profact
Related Histrelin peptides are also available.Please contact for more details.

INCI name: metallothionein, metallothioneins
Purity:70%,80%,95%
Molecular:6500
Grade: cosmetic
Appearance:white powder

2.Functions:
Metallothionein(MT) can eliminate free radicals and prevent aging; to lift heavy metal toxicity; involved in the metabolism of trace elements in the human body; enhance immune function and has the ability to adapt to a variety of adverse state; prevent cancer cells; resistance to apoptosisand so on.

Name:Abarelix Acetate(Plenaxis)
Cas No: 183552-38-7
Formula: C72H95ClN14O14
Molecular:1416
Sequence:Ac-D-2-Nal-D-4-Cl-Phe-D-3-Pal-Ser-N-Me-Tyr-D-Asn-Leu-Lys(ipr)-Pro-D-Ala-NH2
Also known as: Plenaxis, Plenaxis depot, PPI-149, Abarelix-Depot

INCI name: Methyl Undecenoyl Leucinate
Purity:>95%
Appearance: white powder
Grade: cosmetic
Source: synthetic
Stability: stable
Additive: 30 PPM
2.Function: Whitening

Name:Alarelin Acetate
Cas No: 79561-22-1
Formula: C56H78N16O12
Molecular:1167.31
Sequence: pyroGlu-His-Trp-Ser-Tyr-D-Ala-Leu-Arg-Pro-NH-ethyl
Also known as: 79561-22-1, AGN-PC-00J5UN, 67910-55-8, [D-Ala6,Des-Gly10]-LH-RH Ethylamide,pyroGlu-His-Trp-Ser-Tyr-D-Ala-Leu-Arg-Pro-NH-ethyl

Name:Calcitonin Acetate(Salmon)
Cas No: 47931-85-1(net)
Formula: C145H240N44O48S2
Molecular: 3431.85
Sequence: CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP
Purity:98%
Appearance: white powder
Source: synthetic
Also known as: Calcihexal, Calcimar, Cibacalcin, Fortical, Miacalcin, Salcatonin,

Name: Hexanoyl Dipeptide-3 Norleucine Acetate
Grade: cosmetic
Purity: >95%
Source: synthetic
MSDS and COA: available for your reference
Recommended use level: 0.5 3 % (corresponds to 0.5 3 ppm of pure peptide)
Capacity: 200g per month
Appearance: white powder

INCI name: Dipeptide-11
Purity: 95%
Grade: cosmetic
COA and MSDS: available for your reference
Stability: stable
Source: synthetic
Capacity: 1kg per month
Appearance: white powder
2.Usage: anti-aging, anti-oxidant

INCI name:Dipeptide-6
Cas No: 18684-24-7
MF: C10H16N2O4
Molecular:228.25
Appearance: white to pale yellow powder.
Solubility: soluble in water
Source: synthetic
COA and MSDS: available for your reference
Grade: cosmetic
Capacity: 1kg per month
Appearance: white powder

Name: Lipospondin
Formula: C21H35N5O4
Molecular:685
Sequence: N-Elaidoyl-KFK
Purity: 95%
Grade: cosmetic
Source: synthetic
Stability: stable
Appearance: white powder
MSDS and COA: available for your reference
Delivery: promptly from stock
2.Usage: prevent age-associated dermal alterations
3.Description N-Elaidoyl-KFK as well as KFK were shown to activate LAP-TGF-beta both in vitro, using a solid phase assay with immobilized LAP-TGF-beta, and ex vivo using human dermal fibroblasts cultures. In both assays, as much as up to 10% of LAP-TGF-beta added could be recovered as active form. KQK, KQFK as well as their lipopeptide counterparts were inactive. Elaidyl-KFK-mediated LAP-TGF-beta activation led to up-regulation of collagen and TIMP-1 production and down regulation of PMA-induced MMP-1 expression in fibroblasts cultures. Those effects could be suppressed by supplementing cell culture medium with blocking TGF-beta antibody. Elaidyl-KFK inhibited MMP-2, MMP-9, MMP-3, MMP-1, in vitro with IC(50) equal to 1.2, 1.0, 0.24 and 8.9 microM, respectively. Its ex vivo inhibitory capacity, as assessed using skin tissue sections, towards the elastin-degrading capacity of MMP-9 was even more pronounced. At a 1 microM concentration, the lipopeptide decreased by up to 80% enzyme activity. Thus, "Lipospondin," i.e. elaidyl-KFK might be considered as a promising model compound to prevent age-associated dermal alterations.

Name:Atosiban Acetate

Cas No: 90779-69-4 (net),914453-95-5(acetate)
Formula: C45H71N11O14S2
Molecular:1054.24
Sequence:MPr-D-Tye(OEt)-Ile-Thr-Asn-Cys-Pro-Orn-Gly-NH2
Also known as: Tractocile (TN), UNII-0P5DNO7CEF, D07475, 914453-95-5

Name:Aviptadil Acetate
Cas No:40077-57-4(net),
Formula: C147H237N43O43S
Molecular: 3326.78
Sequence:His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH2
Also known as: Aviptadil Acetate, Vasoactive intestinal octacosapeptide, AN-7541, FT-0659889, I06-1835, 3B3-081674

INCI Name:Biopeptide EL,Lipopeptide Acetate,Palmitoyl Oligopeptide-3,Palmitoyl Hexapeptide-12,Palmitoyl Hexapeptide)
Reference: Dermaxyl(ceramide 2+ Palmitoyl Hexapeptide-12), Bio-bustyl PH(palmitoyl tripeptide-1+ Palmitoyl Hexapeptide-12), Corum 8806 / 8816 / 8816CC
Cas No: 171263-26-6 
Formula: C38H68N6O8
Molecular: 736.98
Sequence: Pal-VGVAPG-OH
Purity: 95%
Source: synthetic
Grade: cosmetic
Stability: stable
Solubility: soluble in water
Odor: no
Additive: 100 PPM
Delivery: promptly from stock
Capacity: 700g per month
Appearance: white powder
2.Usage: Skincare and make-up geared to preventing and fighting wrinkle

INCI name: Decapeptide-12
Reference: Lumixyl
Cas No: 137665-91-9
Sequence: H-Tyr-Arg-Ser-Arg-Lys-Tyr-Ser-Ser-Trp-Tyr-OH
Purity: 95%
Grade: cosmetic
COA and MSDS: available for your reference
Solubility:� slightly soluble/soluble in water
Stability:� stable
Risk:� irritation, low irritation to skin, eye
Ph value: 6.0-7.5
Dosage: 100 PPM
Source: synthetic
Capacity: 500g per month
Appearance:� white to pale yellow powder
Description:Decapeptide-12 reduces the appearance of hyperpigmentationâ??age spots, sun spots, uneven skin tone and photo damageâ??without the typical side effects of other brighteners like irritation and redness. Plus, soothing antioxidants like licorice root also ease sensitive skin.